<span> C.It transmits genetic information to the next generation. The key role of DNA is </span>to store genetic information for long term. It contains all components and basic structures of the cells, including RNA and proteins. They regulate how these genetic information will be expressed or transmitted.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
B. The U.S stock market crash and Franklin D Roosevelt’s policies
Answer:
- Diploid → Prophase, metaphase, and anaphase
- Haploid → Telophase
Explanation:
During prophase I, chromosomes get condensed. Each of the chromosomes gets in pair with its homologous one. They do so to make the crossing-over possible, a stage where they interchange their parts → 2n
During metaphase I, each of the homologous pairs is driven to the equatorial plane, where they randomly line up → 2n
During anaphase I, occurs the independent separation of homologous chromosomes that migrate to opposite poles of the cell. This separation generates different chromosomal combinations in the daughter cells. There are two alternatives per homologous pair → 2n
In telophase I, half of the chromosomes are already in one of the poles, while the other half is on the other pole. Each group of chromosomes has now half the number of the original cell. The nuclear membrane forms again in each pole → n
Finally, occurs cytokinesis, which involves the invagination of the cell membrane and cytoplasmic division.
The two new cells are ready for meiosis II.
The enzyme will be transported to either the cytoplasm or the mitochondria to perform the functions.
<h3><u>Explanation:</u></h3>
Cellular respiration is the process by which a living cell burns nutrients like glucose, fats, or even proteins to produce energy molecules namely ATP to perform its daily works. This cellular respiration, which is mainly aerobic, takes place both in cytoplasm and mitochondria.
The glycolysis part of the cellular respiration takes place in the cytoplasm. The enzymes that take part in the glycolysis cycle reaches to cytoplasm from ribosome to perform.
But both the Kreb's Cycle and the Electron Transport chain take place in mitochondria. Kreb's Cycle takes place in mitochondria matrix and ETC takes place in inner mitochondrial membrane. Although ETC isn't a enzymatic process, Kreb's Cycle is fully enzymatic and the enzymes reaches from ribosomes inside mitochondria by transporters.
