<span> It is called the Calvin Benison Cycle</span>
The soon to be male organism, developing from the zygote, receives or inherits the X chromosome from his mother. His father provides him the y chromosome, the smaller of the 2 sex chromosomes.
Usually blood transports nutrients
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The bones of skeletal system serve to protect the body's organs and support the weight of the of the body ,giving the body it's shape
Explanation:
The muscles of the muscular system attach to these bones, pulling on them to allow for movement of the body
