3 years ago

Jim had 5/7 of a pound of candy. she ate 1 3/4 of that candy. how many pounds of candy did he eat?

Mathematics

1 answer:

harkovskaia [24]3 years ago

5 0

What she ate is
(13/4)×(5/7)
65/28 pounfs of candy

You might be interested in

A church has 8 bells in its bell tower. Before each church service 5 bells are rung in sequence. No bell is rung more than once.

Basile [38]

Use the ! tool to find the # of combinations.

8!/5! = 40,320/120 = 336

8 0

4 years ago

Read 2 more answers

You are about to toss

Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0

3 years ago

What is the Mean Average deviation from the Mean?<br> Numbers: 6, 2, 3, 3, 2, 2

Irina-Kira [14]

Answer:

2.42

Step-by-step explanation:

standard deviation= sqrt(variance)

Variance=E[X2] - E[X]2

E[X] = sum(X)/n=35/9, so E[X]2 = 1225/81

E[X2] =sum(X2)/n = 189/9 = 170/81

Variance= 476/81

Standard deviation = sqrt(476/81) ~2.42

6 0

3 years ago

The cost of 4 pounds of bananas is $1.88. What is the constant of proportionality that relates the cost in dollars, y, to the nu

aniked [119]

Answer:

47 cent per banana

5 0

3 years ago

Read 2 more answers

The answer to this equation

12345 [234]

Answer:

x=3

Step-by-step explanation:

We are given the equation

$log5x=log(2x+9)$

This can be rewritten as

$log5x-log(2x+9)=0$

Now using the quotient rule for logarithms we can combine these two

$log(\frac{5x}{2x+9} )=0$

Next we can remove the log by using an inverse operation

$10^{log(\frac{5x}{2x+9} )} =10^0\\\\\frac{5x}{2x+9}=1$

Now we can solve for x

$\frac{5x}{2x+9}=1\\\\5x=2x+9\\\\3x=9\\\\x=3$

4 0

3 years ago