1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
MakcuM [25]
3 years ago
15

Jim had 5/7 of a pound of candy. she ate 1 3/4 of that candy. how many pounds of candy did he eat?

Mathematics
1 answer:
harkovskaia [24]3 years ago
5 0
What she ate is
(13/4)×(5/7)
65/28 pounfs of candy
You might be interested in
A church has 8 bells in its bell tower. Before each church service 5 bells are rung in sequence. No bell is rung more than once.
Basile [38]
Use the ! tool to find the # of combinations.

8!/5! = 40,320/120 = 336
8 0
4 years ago
Read 2 more answers
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
What is the Mean Average deviation from the Mean?<br> Numbers: 6, 2, 3, 3, 2, 2
Irina-Kira [14]

Answer:

2.42

Step-by-step explanation:

standard deviation= sqrt(variance)

Variance=E[X2] - E[X]2

E[X] = sum(X)/n=35/9, so E[X]2 = 1225/81

E[X2] =sum(X2)/n = 189/9 = 170/81

Variance= 476/81

Standard deviation = sqrt(476/81) ~2.42

6 0
3 years ago
The cost of 4 pounds of bananas is $1.88. What is the constant of proportionality that relates the cost in dollars, y, to the nu
aniked [119]

Answer:

  47 cent per banana

5 0
3 years ago
Read 2 more answers
The answer to this equation​
12345 [234]

Answer:

x=3

Step-by-step explanation:

We are given the equation

log5x=log(2x+9)

This can be rewritten as

log5x-log(2x+9)=0

Now using the quotient rule for logarithms we can combine these two

log(\frac{5x}{2x+9} )=0

Next we can remove the log by using an inverse operation

10^{log(\frac{5x}{2x+9} )} =10^0\\\\\frac{5x}{2x+9}=1

Now we can solve for x

\frac{5x}{2x+9}=1\\\\5x=2x+9\\\\3x=9\\\\x=3

4 0
4 years ago
Other questions:
  • The equation 18+0.25p= c gives the cost c in dollars that a store charges to deliver an appliance that weighs pounds. Use the eq
    11·1 answer
  • How to write 65,000 in scientific notation
    5·2 answers
  • Given a second order linear homogeneous differential equation a2(x)y′′+a1(x)y′+a0(x)y=0 we know that a fundamental set for this
    11·2 answers
  • A spinner is divided into equal parts 1-5. George spun the spinner 300 times
    5·1 answer
  • (x 5 + y 5) divided by (x + y) PLEASE HELP ME!!!
    7·1 answer
  • The area of the base of a triangular pyramid with faces that are equilateral triangles is 64 ft squared. Can you find the surfac
    5·1 answer
  • Please help this is due today!
    11·2 answers
  • You are responsible to provide tennis balls for a tournament. You know that a ball bounces like new when it is dropped and it bo
    9·1 answer
  • 7) The fee for charging an electric car at Station A is $2 to start, and then $4 for each hour or fraction of an hour.
    14·1 answer
  • 2/9 h = 8<br><br> h=<br><br> Pls tell me what h = !
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!