Answer: An area with lots of different kinds of plants and animals.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
A-The composition of their cell walls
Explanation: plant cell walls components is glucose. Fungi cell will components is chitin
Answers;
Ancient China
Earthenware, stoneware, and bronze were common mediums used in ancient China.
Earthenware is clay fired at relatively low temperatures of between 1,000 to 1,150 degrees.
Stoneware is made from a particular clay which is fired at a higher temperature of 1,200°C. This results in a more durable material, with a denser, stone-like quality.
