Answer:
Its B I think (I'm not 100% sure)
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Cold water can hold more dissolved oxygen than warm water. In winter and early spring, when the water temperature is low, the dissolved oxygen concentration is high. In summer and fall, when the water temperature is high, the dissolved-oxygen concentration is often lower.
Explanation:
Answer:
because the more alike species are The more they have to adapt to try and compete with one another So the more different a species is the less they have to compete
Answer:
Whale
Explanation:
Blue Whale, a bat has its things with another bat, a snake lays eggs.
