Answer:
Its pollination
Explanation: The process by which pollen is delivered to the ovule of a gymnosperm or the stigma of an angiosperm. And a pollinator is an organism or other agents such as wind or water that transfers pollen from one plant to another; most commonly applied to organisms. hope this helps!
Answer:
Answer is explained below.
Explanation:
A. The observed single stranded regions are found in the mRNA.
B. The loops represent introns (Non-coding portions of the mRNAin primary transcript ). The intron sequences are removed to form a mature mRNA by splicing.
C. If the scientist use RNA and DNA from bacteria, loops cannot be seen. Because introns are produced in only eukaryotes but not in prokaryotes.
I think the correct answer from the choices listed above is option A. Horned toads squirt blood from their eyes as a means of evading predators. This is their final defense action which frightens their predators. Hope this answers the question. Have a nice day.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
A)legumes
Explanation:
A legume is a group of plants which belongs to the family Fabaceae. These plants can be characterised by having root nodules in their roots especially which are the house of the nitrogen-fixing bacteria.
The legumes are known for their seeds and fruits which are very rich in protein and low carbohydrates so they are commercially grown by the farmers.
In the give question, since the given bean plants belongs to the family Fabaceae which are very rich in protein therefore legumes is the correct answer.
