This has happened before in Yellow Stone National Park in CA. Removing a species form the Pyramid causes the ecosystem to collapse, as species become over hunted and others are starved. One type of organism could become overpopulated, therefor lack of natural variation.
Find latitude and longitude
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: Glucose is the basic sugar produced during photosynthesis in stroma part of chloropast.
Explanation:
It occurs in a series of steps, which together constitute Calvin cycle. Glucose, the basic sugar is thus produced in stroma part of chloroplast as explained above.
Answer;
They have revealed new information about cell structure and processes.
Explanation;
-The Cell Theory states that, All living things are made up of cells, Cells are the basic units of structure and function in living things, and that new cells are produced from existing cells.
-Most microscopes use lenses to magnify the image of an object by focusing light or electrons.
-The Invention of the Microscope helped the development of the cell theory because it allowed the scientists to actually discover that everything was made up of cells, and what cells do to come up with that theory. If the scientists did not see that cells existed, they could not have observed the cells easily and they would not be able to construct the cell theory.
