In external respiration carbon dioxide move from capillaries to alveoli, while oxygen move from alveoli to capillaries in internal respiration.
Answer:
1. Orchids
2. Blue Butterfly Pea
3. Spanish shawl
4. Rose - flowered Jatropha
The hydrophilic molecules are the polar molecules which establishes the hydrogen bonding with the water molecules. Hence the hydrophilic molecules are water loving molecules. The hydrophobic molecules are unable to establish any hydrogen bonding with the water molecules. Hence the hydrophobic molecules are water repellent molecules.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:Beginning with energy sources obtained from their environment in the form of sunlight and organic food molecules, eukaryotic cells make energy-rich molecules like ATP and NADH via energy pathways including photosynthesis, glycolysis, the citric acid cycle, and oxidative phosphorylation.
Explanation:
Your body cells use the oxygen you breathe to get energy from the food you eat. This process is called cellular respiration. During cellular respiration the cell uses oxygen to break down sugar. Breaking down sugar produces the energy your body needs.
