Answer:
The gene for beta-galactosidase turns off.
Explanation:
The gene that codifies the beta-galactosidase enzyme is part of the <em>lac</em> operon, which also contains two other genes that produce enzymes involved in the metabolization of lactose.
Between glucose and lactose, the bacteria will preferentially use glucose as an energy source. On the other hand, lactose is a dimer, and thus a series of enzymes are needed to process lactose before its use as an energy source.
If there is no lactose present, the genes contained inside this operon are turned off (the operon is repressed).
A sunflower is a shade of yellow
Hello how are you feeling today I miss your birthday so much I love it hell we
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
