1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
borishaifa [10]
4 years ago
13

What neutrilizes calcium and magnesium in hard water

Health
1 answer:
Deffense [45]4 years ago
7 0

Calcium and magnesium dissolved in water are the two most common minerals that make water "hard." The degree of hardness becomes greater as the calcium and magnesium content increases and is related to the concentration of multivalent cations dissolved in the water.

You might be interested in
A client is at the clinic for her yearly physical and is found to be anemic. What information from her history would most likely
Allushta [10]

Answer: her parents medical history

Explanation:

8 0
3 years ago
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
2 years ago
Which step is first when performing diagnostic coding for Hirschsprung’s disease?
madam [21]
The first step will be the physician's diagnostic statement, which is an evaluation listing the patient's condition and medical term. 
5 0
3 years ago
Why do we have stress responses
Wittaler [7]

Answer:

how this helps

Explanation:

Stress responses help your body adjust to new situations. Stress can be positive, keeping us alert, motivated and ready to avoid danger. For example, if you have an important test coming up, a stress response might help your body work harder and stay awake longer.What is stress?

Stress is a normal human reaction that happens to everyone. In fact, the human body is designed to experience stress and react to it. When you experience changes or challenges (stressors), your body produces physical and mental responses. That’s stress.

Stress responses help your body adjust to new situations. Stress can be positive, keeping us alert, motivated and ready to avoid danger. For example, if you have an important test coming up, a stress response might help your body work harder and stay awake longer. But stress becomes a problem when stressors continue without relief or periods of relaxation.

7 0
3 years ago
How many people die from smoking related diseases every year in the USA?
jek_recluse [69]
More than 480,000 , and more than 41,000 deaths due to secondhand smoke exposure
6 0
3 years ago
Other questions:
  • Leaning toward a person conveys _______________ in the message.
    13·1 answer
  • Explain why the following scenario fails to meet the regulations for a registered child care center.
    8·2 answers
  • You are Driving on a two-way highway and you see an oncoming motorcycle approaching in your lane the motorcycle is getting dange
    9·2 answers
  • How does working together straighten a friendship?
    11·1 answer
  • Which structures in the skin help to regulate body temperature? Check all that apply.
    7·2 answers
  • Please help, marking brainliest
    13·1 answer
  • An eating disorder is a physical disease in which the individual is cured once she/he becomes a healthy weight. A. True B. False
    8·2 answers
  • Human diploid cell vaccine is used to prevent polio.a) Trueb) False
    15·2 answers
  • Which of the following statements processes does the body NOT use protein to perform
    9·1 answer
  • How often should you visit your doctor?
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!