1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
soldi70 [24.7K]
3 years ago
6

5. Find the distance between the given points. A = (2, 0) and B = (0,9)

Mathematics
2 answers:
spayn [35]3 years ago
4 0

Answer: 9.21

Step-by-step explanation:

To find the distance between two points find the difference between the x and y values then square them and add them to find their square root.

0-9 = - 9

2 - 0 = 2

(-9)^2 + 2^2 = d^2      d is the distance

81 + 4 = d^2

85 = d^2  

d = \sqrt{85}

d= 9.23   is about 9.23  when rounded to the nearest hundredth

nika2105 [10]3 years ago
3 0

You could use a coordinate plane to solve this.

To reach B from point A, move 2 to the left and 9 down. Hope this helped, sorry I was in a rush-

You might be interested in
Is 3x = 2y a linear equation?​
mel-nik [20]

Answer:

yes

Step-by-step explanation:

8 0
3 years ago
Read 2 more answers
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
3 years ago
Read 2 more answers
41. You water your roses every sixth
ICE Princess25 [194]

Answer:

30

Step-by-step explanation:

because 6 × 5 equals 30 and when you're looking for when something's going to be the same you got to do what your numbers are times each other

5 0
3 years ago
I'm confused. Can someone help?
VARVARA [1.3K]

a.

The polynomial w^2+18w+84 cannot be factored

The perfect square trinomial is w^2+18w + 81

----------

The reason the original can't be factored is that solving w^2+18w+84=0 leads to no real solutions. Use the quadratic formula to see this. The graph of y = x^2+18x+84 shows there are no x intercepts. A solution and an x intercept are basically the same. The x intercept visually represents the solution.

w^2+18w+81 factors to (w+9)^2 which is the same as (w+9)(w+9). We can note that w^2+18w+81 is in the form a^2+2ab+b^2 with a = w and b = 9

================================================

b.

The polynomial y^2-10y+23 cannot be factored

The perfect square trinomial is y^2-10y + 25

---------

Using the quadratic formula, y^2-10y+23 = 0 has no rational solutions. The two irrational solutions mean that we can't factor over the rationals. Put another way, there are no two whole numbers such that they multiply to 23 and add to -10 at the same time.

If we want to complete the square for y^2-10y, we take half of the -10 to get -5, then square this to get 25. Therefore, y^2-10y+25 is a perfect square and it factors to (y-5)^2 or (y-5)(y-5)

8 0
3 years ago
The formula P = 6s gives the formula for the perimeter of a regular hexagon with side length s. What is the perimeter of a regul
stellarik [79]
YOU NEED A BETTER SCHOOL
6 0
3 years ago
Other questions:
  • Two angles are drawn below. the measure of angle x is 90<br><br>a. 20<br>b. 60<br>c. 100<br>d. 120
    15·2 answers
  • Alinethatincludesthepoint(2, 7)has slope of 5 . what isitsequationin slope -intercept form
    15·1 answer
  • Priya wants to buy three tickets for a concert. She has earned $135 and each ticket costs $50. She burrows the rest of the money
    7·1 answer
  • What’s the correct name for that line?
    8·1 answer
  • Joan's dinner contains 210 grams of carbohydrate, 60 grams of protein, and 52 grams of fat. What percent of kilocalories in this
    12·1 answer
  • (6e-3f-3/4) in a equivalent expression​
    12·1 answer
  • Find the area of the polygon
    10·2 answers
  • Which transformation of triangle T will produce triangle U?
    11·1 answer
  • Find y.<br> please help if you can
    15·2 answers
  • PLEASE HELP 100 POINTS AND BRAINLIEST
    6·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!