Complete Question
The complete question is shown on the first uploaded image
Answer:
a)
An ion exchange resin with positively charge group will stick negatively charged ion so in our case 1st and 3 rd sequence are positively charge they will not stick on resin but second will stick. among 1st and 2nd later has less pH so 1st peptide will come first then second last only 3rd will come
b) An ion exchange resin with negatively charge group will stick positively charged ion so sequence last one will be 1st which has more positive charge. in resin 2nd peptide sequence will come first . then 3rd will come last only first peptide sequence will come
c)
among this second one is small peptide so we can separate second one with first using size exclusion gel filtration
d) The logos are read as follows, the letters represent AA and numbers on the x-axis the position, relative positions represent conservation at that position. Sequence three positions 9-16 has a similar sequence as the motif represented by the logo. You can detect it by looking at 1st(G), 6,7, and 8th letters (GKS)
Explanation:
pH > pKa,
So "everything" will be in the de-protonated form. For an individual amino acid, "everything" is composed of the following: Amino Group, Carboxyl Group and side chain
Carboxyl Group has a pKa of about 5, at 7 the Carboxyl group will be DEPROTONATED (-1 charge)
Amino Group has a pKa of about 9-10, at pH 7 the Amino group will be PROTONATED (+1 charge)
ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG
Ala - Thr - Lys - Asn - Arg - Ala - Ser - Cys - Leu - Val - Pro - Lys - His - Gly - Ala - Leu - Met - Phe - Trp - Arg - His - Lys - Gln - Leu - Val - Ser - Asp - Pro - Ile - Leu - Gln - Lys - Arg - Gln - His - Ile - Leu - Val - Cys - Arg - Asn - Ala - Ala - Gly
At pH 7 net charge of above sequence is 7.2
2. GPYFGDEPLDVHDEPEEG
Gly - Pro - Tyr - Phe - Gly - Asp - Glu - Pro - Leu - Asp - Val - His - Asp - Glu - Pro - Glu - Glu - Gly
At pH 7 net charge of above sequence is -6.9
3. PHLLSAWKGMEGVGKSQSFAALIVILA
Pro - His - Leu - Leu - Ser - Ala - Trp - Lys - Gly - Met - Glu - Gly - Val - Gly - Lys - Ser - Gln - Ser - Phe - Ala - Ala - Leu - Ile - Val - Ile - Leu - Ala
at pH 7 net charge will be 1.1
a)
An ion exchange resin with positively charge group will stick negetively charged ion so in our case 1st and 3 rd sequence are positively charge they will not stick on resin but second will stick. among 1st and 2nd later has less pH so 1st peptide will come first then second last only 3rd will come
b)
An ion exchange resin with negatively charge group will stick positively charged ion so sequence last one will be 1st which has more positive charge. in resin 2nd peptide sequence will come first . then 3rd will come last only first peptide sequence will come
c)
among this second one is small peptide so we can separate second one with first using size exclusion gel filtration