1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
zavuch27 [327]
3 years ago
15

When a_ ( sublimes, a converts to a_ (ii) This phase change is_ because energy is_(iv) when the intermolecular forces_ [M]__ (i)

(ii) (iii) (iv) (v) a. solid Liquid endothermic absorbed form b. solid Gas endothermic absorbed break c. solid Liquid exothermic released break solid Gas exothermic released form e gas Solid exothermic released form d
Chemistry
1 answer:
DedPeter [7]3 years ago
3 0

Answer: Option (b) is the correct answer.

Explanation:

Sublimation is defined as the process in which a solid substance changes directly into gaseous phase without undergoing into liquid phase.

For example, when naphthalene balls are kept in a trunk or cupboard then after some days or months it changes into gas. Hence, they become consumed.

Also during this process energy is being absorbed by the solid substance because for breaking bonds energy is always absorbed by a substance. Only then it can change into liquid or vapor state.

So, a chemical process in which energy is being absorbed by a reaction is known as endothermic reaction. And, if heat energy is being released by the reaction then it is known as an exothermic reaction.

Therefore, we can conclude that when a solid sublimes, a solid converts to a gas. This phase change is endothermic because energy is absorbed when the intermolecular forces break.      

You might be interested in
The amount of heat energy needed to heat 200 g of water from 15 °C to its boiling point, and boil it, is
Svetllana [295]

can you explain it further

4 0
2 years ago
Iron ore exists as Fe2O3. In order to remove the oxygen and generate pure iron, the oxygen must be transferred to another molecu
Svetllana [295]
The answer would be c
4 0
2 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
2 years ago
All of the following can be recycled except
Lunna [17]
Compact fluorescent bulbs because they made out of glass that will break and will dye and then they can't be used again
7 0
3 years ago
How many grams are in 2.3 x 10^23 atoms of silver
ozzi
There are 41.1984 grams of silver in 2.3x 10^23 atoms of silver
4 0
3 years ago
Other questions:
  • Calculate the energy provided by a slice of bread containing 2 g of protein, 1 g of fat, and 20 g of carbohydrate. record your a
    8·1 answer
  • Which term refers to the process by which ions that have entered solution are kept in solution?
    7·2 answers
  • is a cation or anion. In the second row, write the symbol for the ion that an atom of fluorine is mostly likely to form and then
    7·2 answers
  • What figurative language is this
    5·1 answer
  • The compound consists of 40% carbon and 6.71% hydrogen. Its mass of 1 liter of steam is 2.4 g. What is the formula of the compou
    11·1 answer
  • Applying a force can make an electron shift from one atom to another causing what?
    15·1 answer
  • Layer F can help scientists to correlate the relative age of another layer. What makes layer F useful for relative dating?
    8·2 answers
  • Is Fe2+ + 2e- = Fe an oxidation or reduction
    14·1 answer
  • Match the causes with their effects
    14·1 answer
  • What is the ph of a peach with a [ –oh] = 3.2 × 10 –11 m?
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!