Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Organ- a group of tissues in a living organism
examples- heart, lungs, liver, kidney, and stomach
Which mode of inheritance produces heterozygotes with phenotypes that differ from either homozygote but typically more closely resembles one homozygous phenotype than the other?"
A) complete dominance
B) incomplete dominance
C) codominance
D) epistasis
E) incomplete penetrance
Answer:
B) incomplete dominance
Explanation:
Incomplete dominance occurs when the dominant allele of a gene is not able to mask the expression of the recessive allele completely. This results in the expression of a phenotype in the heterozygous genotypes that differ from both homozygous genotypes. However, the phenotype of the heterozygote is closer to one of the homozygous genotypes.
For example, the petal color in four o'clock plant is controlled by a gene with two alleles R and r. Here, the "R" allele can not produce enough pigment in heterozygous conditions to completely mask the expression of the "r" allele and the phenotype of the "Rr" plant is "pink". On the other hand, the phenotype of "RR" plant is red while that of the "rr" plant is "white".
<span>Humans did not evolve from apes,
gorillas or chimps. We are all modern species that have followed
different evolutionary paths, though humans share a common ancestor with
some primates, such as the African ape. The timeline of human evolution is long and controversial, with significant gaps.</span>
