Answer:
The study of fish is called Ichthyology.
Explanation:
Fish specimens are identified in the field by ichthyologists. Ichthyology is the field of study that deals with fishes. Taxonomy (classification and the description of new species) and biogeography are the two main areas of focus for museum ichthyologists (patterns of distribution).
Ichthyology is the field of study that deals with fishes. Taxonomy (classification and the description of new species) and biogeography are the two main areas of focus for museum ichthyologists (patterns of distribution). Large reference collections of preserved specimens are kept in museums as a permanent resource for present-day researchers as well as for future ones.
See the attachment for a visual.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The answer should be an unconformity
The CPT code that will be reported for moderate sedation is 9914 [4].
This is the government approved CPT code for moderate sedation for patients that are five years old and older and the code is used when the moderate sedation and the other needed procedure is performed by the same health provider for the intraservice period of 15 to 30 minutes.
