1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Lady bird [3.3K]
3 years ago
13

Fahd is trying to write a focused scientific question. He writes, “Does the material something is made of affect its density?” H

ow could Fahd’s question best be rewritten?
Biology
1 answer:
babymother [125]3 years ago
7 0

Answer: So basically we have to know does the material's characteristics/compositions affect its density?

Explanation: Density is defined as the ratio of the mass of a material to its volume at a specific temperature and pressure. The Density of material is changed by changing its mass to volume ratio or by changing its temperature or by changing its pressure, the density of material changes. The Density of material is changed by changing its mass to volume ratio or by changing its temperature or by changing its pressure, the density of material changes. From the above description, it can be inferred that a material's composition or chemical characteristics may remain unchanged if density changes by changing the pressure or temperature of the material.

You might be interested in
Describes the product of rna translation
emmasim [6.3K]

Answer:

Explanation:

In translation, messenger RNA (mRNA) is decoded in the ribosome decoding center to produce a specific amino acid chain, or polypeptide. The polypeptide later folds into an active protein and performs its functions in the cell.

6 0
4 years ago
Paleontologists have found evidence that after a major extinction occurs, _____. there is no particular pattern of speciation ma
Juli2301 [7.4K]
Up and downs of biodiversity
4 0
3 years ago
Read 2 more answers
What is the best way to emphasize a point when giving a speech?
ehidna [41]
The answer is a I think
3 0
3 years ago
Read 2 more answers
A cell without a nucleus is known as<br><br><br> Help thank you
tino4ka555 [31]

Answer: prokaryotic cells

Explanation:

3 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Other questions:
  • Label the steps of electron transport leading to oxidative phosphorylation where atp is synthesized from adp using the energy st
    13·2 answers
  • Genetically-modified organisms (GMOs) have included corn crops engineered to produce a natural pesticide to kill a certain insec
    9·1 answer
  • Which of the following best describes why someone with an immunodeficiency disorders may get sick more easily than someone witho
    10·2 answers
  • What is the difference between endocytosis and exocytosis
    11·2 answers
  • Which of the following would not regulate genes in a eukaryote
    6·1 answer
  • Can somebody help me
    7·2 answers
  • I need some ideas for experiments that show the process of evolution by natural selection. if this could be answered asap that w
    7·1 answer
  • Why do you want a small motor unit for fine motor skills?
    11·1 answer
  • Which of the traits below are unique to animals?
    10·1 answer
  • What do the polar bears, reindeer, and shrubs that live in a single area make up?
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!