4. Why do leaves change colors in the fall?

Biology

2 answers:

joja [24]4 years ago

6 0

Answer:

The pigment that causes leaves to be green is chlorophyll. Chlorophyll is important for plants to make food using sunlight. ... As chlorophyll goes away, other pigments start to show their colors. This is why leaves turn yellow or red in fall.

Explanation:

In autumn when it starts to get cold, some plants stop making chlorophyll. Instead, those plants break down chlorophyll into smaller molecules. As chlorophyll goes away, other pigments start to show their colors. This is why leaves turn yellow or red in fall.

ivolga24 [154]4 years ago

6 0

Answer:

to give nutrients to the grass/the tree itself

Explanation:

once the Winter goes by, the leaves decay and give off nutrients for the soil to regain the nutrients it needs to keep the plants safe and healthy

i hope this help ;)

You might be interested in

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0

4 years ago

Which statement (related to body directions) is true?

jek_recluse [69]

The best answer to the question above is The elbow is distal to the wrist.

Our body is made up of eight regions. To avoid confusion, there are clinical anatomy terms to describe these eight body regions. These are:
Superior, Inferior, Anterior.,Posterior, Median, Medial, Lateral, Proximal, Distal, Superficial, .Intermediate, Deep, Unilateral, Bilateral, Ipsilateral, and Contralateral.

8 0

3 years ago

Read 2 more answers

The blackberry is an example of which of the following fruit types?

leonid [27]

If i am not mistaken it is the aggregate fruit classification

3 0

3 years ago

Plz follow me plz plz plz

inna [77]

Answer:ok

Explanation:

6 0

3 years ago

Read 2 more answers

What is the shape of a drop of water?

Shalnov [3]

If the drop is small enough, it is a perfect sphere.
 A sphere is the geometrical shape that has the smallest surface area for its volume. The drop takes this shape because water molecules tend to stick to each other. So, when not confined by a container, and with nothing around it to distort its shape, a very tiny water drop is perfectly round like a ball because the water molecules are pulling inward toward each other. 

If the drop is larger like a raindrop in free-fall, it has a domed top and a semi-flattened bottom because as it falls it must push the air out of its way. That "upward" push of the air being displaced causes the falling drop to have a rather flattened bottom. 

Contrary to popular misconception, a free-falling raindrop is not shaped like a teardrop -- round on the bottom and pointy on top.

From:https://www.quora.com/When-a-water-drop-falls-does-it-form-a-circular-shape

7 0

4 years ago