Answer:
Molarity of NaOH = 0.025 M
Explanation:
Given data:
Molarity of HCl = C₁ = 0.05 M
Volume of HCl = V₁= 50 mL
Molarity of NaOH = C₂=?
Volume of NaOH =V₂= 100 mL
Solution:
Formula:
C₁V₁ = C₂V₂
C₁ = Molarity of HCl
V₁ = Volume of HCl
C₂ = Molarity of NaOH
V₂ = Volume of NaOH
Now we will put the values:
C₁V₁ = C₂V₂
0.05 M × 50 mL = C₂ × 100 mL
2.5 M.mL =C₂ × 100 mL
C₂ = 2.5 M.mL /100 mL
C₂ = 0.025 M
Answer:u would have 40
Explanation:
because ur taking them away
Answer:
i dont no ehh ahh i answer this question and this question is an dibitual sence
Explanation:
ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn
mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks
<span>If you do not wash and dry the thermometer after every time you use it in this scenario, the temperature could be affected by the NaOH residue. This could make it so that your findings were inaccurate, so in order to be efficient, this precaution needs to be taken.</span>
The area used to be covered by an ocean
