How does the biosphere interact with the atmosphere

1 answer:

5 0

As all the spheres, the biosphere and the atmosphere are in constant interaction with each other. The atmosphere is the sphere made out of gases, while the biosphere is the sphere made out of all the living organisms. The living organisms use the gases from the atmosphere for their functioning. As they use them, they either store them, release them as waste products, or change them. Once their usage is finished, the biosphere releases the majority of the gases back to the atmosphere, being also able to influence its composition on the long run. An excellent example of the interaction between the biosphere and the atmosphere, as well as the effect that it can have, is with the emerging of the cyanobacteria. The cyanobacteria used the carbon dioxide from the atmosphere for the process of photosynthesis. By using the carbon dioxide, the cyanobacteria has reduced the amount of this gas in the atmosphere. On the other hand, once used, the atom of oxygen from the carbon dioxide has been released into the atmosphere, gradually resulting in an increase in the oxygen levels in the atmosphere, making it the second most present gas in it. That resulted into enabling living conditions for other organisms to evolve and develop, and the circle has been continuing ever since.

You might be interested in

Plants obtain food through the process of

TiliK225 [7]

Photosynthieis sry if spelled wrong

7 0

3 years ago

What part of the hemoglobin molecule actually binds the oxygen molecule? what part binds carbon dioxide?

Sladkaya [172]

The Iron in the molecule binds to the oxygen. Carbon Dioxide does not bind to a cell but rather, is carried in the blood as bicarbonate.

3 0

3 years ago

What do sin mean in this picture

wel

Answer:

The sine or sin is a trigonometric function of an angle. The sine of an acute angle is defined in the context of a right triangle: for the specified angle, it is the ratio of the length of the side that is opposite that angle, to the length of the longest side of the triangle (the hypotenuse).

Hope this helps you!

Explanation:

3 0

3 years ago

15 points!

WINSTONCH [101]

D. <span>They all contain carbon as an important part of their structure. Hope this helps you!! =')</span>

5 0

3 years ago

Read 2 more answers

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0

3 years ago