A branch or leaf and here is a link to some flash cards i found
https://quizlet.com/45759526/developmental-anatomy-flash-cards/
(See figure below, where meiosis I begins with a diploid (2n = 4) cell and ends with two haploid (n = 2) cells.) In humans (2n = 46), who have 23 pairs of chromosomes, the number of chromosomes is reduced by half at the end of meiosis I (n = 23).
Answer:
Delivered small RNAs can inhibit protein A production through the RNA interference (RNAi) mechanism, and thus impairs angiogenesis
Explanation:
The pregnancy-associated plasma protein-A is a protease enzyme involved in the formation of new blood vessels by increasing insulin-like growth factor I (IGF-I) bioavailability. Moreover, small RNAs (<200 nucleotides in length, generally 18 to 30 nucleotides) are non-coding RNA molecules that function in RNA silencing through the RNA interference (RNAi) pathway. Small RNAs are widely used in molecular biology laboratories because they can be delivered into specific cells in order to silence target mRNAs such as, in this case, the mRNA encoding protein A, by complementary base pairing and thereby inducing translational repression. In consequence, mRNAs complementary to delivered small RNAs are silenced through RNAi pathways, i.e., by cleavage of the target mRNA and/or mRNA destabilization.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
