1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
expeople1 [14]
3 years ago
9

You tell your mom that you want ₹700₹700₹, 700 as pocket money every month. She can deposit some money in the bank such that the

interest she gets will be equal to the money you need. Her bank offers her interest of 7\%7%7, percent per annum.
How much money should she deposit in the bank?
Mathematics
1 answer:
Colt1911 [192]3 years ago
6 0
Let me think? I’m not sure
You might be interested in
What is the dimension of a rectangle if the perimeter is 198
AfilCa [17]

Answer:

Length = 49.5 unit and width = 49.5 unit

Step-by-step explanation:

Given as , Perimeter of rectangle = 198 unit

so ,as Perimeter of rectangle = 2× ( Length + width)

Or,                                   198 = 2 ×  (Length + width)

Or,                                   \frac{198}{2} = length + width

So, length + width = 99 unit

Now to make area maximum

Length × width = maximum

Or, (99 - width ) × width = maximum

      99 Width - width² = maximum                              Let width = W

Now differentiate both side with respect to W

D(99W - W²)\frac{D(99w - w^2)}{Dw} = 0         as, constant diff is 0

So, 99 - 2w = 0

Or, w = \frac{99}{2}

Or, w = 49.5 unit    and L = 99- 4905 = 49.5 unit      Answer

3 0
3 years ago
The easiest way to find THE SLOPE on a graph? Please HELP
ratelena [41]

Step-by-step explanation:

Pick two points on the line and determine their coordinates

Select one to be (x1, y1) and the other to be (x2, y2)

Finally use the slope intersect equation to calculate the slope:

<em>Formula-</em><em> </em>

<em>y = mx + b </em>

<em></em>

Hope this helps, let me know if you need more information, I'll be glad to help! :)

3 0
2 years ago
A) 5√160=
drek231 [11]

Answer:

a) 20\sqrt{35}

b) 7\sqrt{5}

c) 18\sqrt{2}

d) 5\sqrt{2}

e) 36\sqrt{3}

f) 72

g) 10\sqrt{3}

Step-by-step explanation:

8 0
2 years ago
PLS HELP QUICK I WILL GIVE BRAINLIEST
Volgvan

Answer:

B

Step-by-step explanation:

The equation for B equals a negative answer

7 0
2 years ago
Read 2 more answers
Find the image of the given point
hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0
3 years ago
Other questions:
  • S=(n-2) * 180. Solve for n.
    7·2 answers
  • Which of the following is a type of face found on a Platonic solid
    14·2 answers
  • Anybody know the answer I need help. Please
    11·1 answer
  • A cylinder has a radius of 12 m and a height of 9 m.
    5·1 answer
  • A square pyramid is made up of a base with a side length of 10 inches and faces that are triangles with a height of 12 inches. W
    15·2 answers
  • Does anyone know how to do 8?
    8·1 answer
  • Please help me with this​
    5·1 answer
  • Carlos walked to school on 14 of the 20 school days in February. Which value is equivalent to the fraction of the school days in
    5·1 answer
  • The ratio of boys to girls in a room is 4:9.<br> There are a total of 39 people in the room.
    6·2 answers
  • What is the common difference in the following sequence <br> 2,10,18,26
    7·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!