The surface area will be:
S.A. = 6l²
S.A = 6(100 x 10⁻⁶)²
Volume = l³
Volume = (100 x 10⁻⁶)³
Surface area to volume ratio:
[6(100 x 10⁻⁶)²] / (100 x 10⁻⁶)³
S.A : Vol = 6 x 10⁴
That they are <span>caused by microorganisms.</span>
Based on the scenario, the client who behaves the way he is
in the scenario is likely to behave in a way that his expression of feelings
are being controlled. It could be seen from the way that he is trying to keep
it in despite of the struggle or the scenario that he has experienced.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Which of the following is NOT transported by vascular tissue?
Vascular tissue is transporting food, water, and hormones. <span>4.None Of The Above
Vascular tissue distributes blood which carries food, water, and hormone. They also distribute oxygen and take carbon dioxide to the distant cells.</span>
