Answer:
The similarities in the way barchan and hooked spit forms are:
First, they are formed from sediment or sand movement.
Second, this movement makes them have a peculiar curved form that provides them their major characteristic.
Explanation:
First of all, barchans are sand formations that are created after the accumulation of sand in a place is moved by the wind and provides them a curved form. However, they exist only out of the sea.
Second, hooked spits are formations that happen after sea movement displaces the sediment to create a curved structure that can only exist in the sea. These formations affect the strength and direction of the waves in the sea due to their curved form.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
|
v
Explanation:
photosynthesis creates oxygen, water and glocose(starch) and we take in those and use it in our mitochondrias to create atp so it can hapen all over again.
