1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
yKpoI14uk [10]
3 years ago
5

The blue line and the yellow line trains just arrived at the station.

Mathematics
1 answer:
boyakko [2]3 years ago
6 0

Answer:

After 60 minutes. Least common multiple I think is the reason

Step-by-step explanation:

You might be interested in
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
100 POINTS PLEASE HELP ASAP!!!!!!
Scorpion4ik [409]

Answer:

they spent 20.3 hours every week watching television!

Step-by-step explanation:

Hope it helped :) please mark brainliest :)

3 0
3 years ago
PLSSSS Plsssss help quick
Neporo4naja [7]

Answer:

(x, y) (1,5.5) , (2,5.75) (3,5.83) (4,5.875) (5,5.9)

Step-by-step explanation:

The x values lie on the horizontal line and the y values lie on the vertical line.

In order to find the value of y you must substitute the value of x in the equation given and you must plot you graph using the answers you got which I wrote for you.

NOTE:if there's anything you don't understand let me know.

5 0
3 years ago
A $65 coat is now on sale for $52. What percent discount is given?
leonid [27]
20%, because if 65 is 100, then 52 is 80% out of 65; so 100 - 80 is 20
3 0
3 years ago
Read 2 more answers
Help plssssssssssssss
laila [671]

Answer: (-3,-2)

Step-by-step explanation:

3 0
4 years ago
Read 2 more answers
Other questions:
  • Determine the convergence or divergence of the sequence with the given nth term. If the sequence converges, find its limit. (If
    8·1 answer
  • Whats 1,112,433 rounded to the nearest ten thousand
    12·1 answer
  • A savings account accrues interest at a rate of 3.0% yearly. If someone opens an account with $2,500, how much money would the a
    12·1 answer
  • ‼️Name the vertex and sides of the angle below
    15·1 answer
  • Given line segment AC with the endpoint A(4,6) and midpoint B(-2,3), find the other endpoint C
    13·1 answer
  • X=Y + 2 <br> X^2 + Y^2 +XY = 49<br> Find X, Y
    9·2 answers
  • A store had homemade sweaters for $20 off the original price. Aunt Ethel jumped at the bargain and bought a sweater for all 5 me
    12·1 answer
  • MONEY Gillian, Roger, LaToya, and Ichiro had lunch at a restaurant. After sales tax and tip were added, the total bill was $23.8
    15·1 answer
  • Find the exact length of the third side .
    14·1 answer
  • Adam has 18 counters He gives 10 of the counters to Lesley
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!