1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
ZanzabumX [31]
3 years ago
12

Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis

Mathematics
1 answer:
arsen [322]3 years ago
6 0

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

You might be interested in
Colin invests £100 into his bank account.
kramer

The answer is $131.59

After year 1

104

Year 2

108.16

Year 3

112.49

Year 4

116.98

Year 5

121.67

Year 6

126.53

Year 7

$131.59

8 0
3 years ago
Read 2 more answers
Use the rule ƒ(x) = -2x + 3 to complete the statement. When x = 5, ƒ(x) = _____.
Mazyrski [523]

Answer:

-7

Step-by-step explanation:

To solve this equation, plug your x value in and simplify.

-2x + 3

-2(5) + 3

-10 + 3

-7

3 0
3 years ago
Read 2 more answers
Someone answer this question I know your reading this.
IgorC [24]

Answer: A.

Step-by-step explanation:

To answer this, you must first understand what fractional exponents mean.

An exponent of 1 is simply the base itself. 7^1 = 7.

An exponent of 2 is squaring the base: 7^2 = 49.

An exponent of 1/2 is taking the square root of the base: 7^(1/2) = sq root of 7

Therefore, an exponent of 1/3 is taking the cube root of the base.

In this case, the base is 2.03 * t.

Therefore, this can be represented as the cube root of the product of 2.03 and the age of the mammal, so the answer is A.

3 0
3 years ago
Please help me ive been stuck on this question for days! Thank you
Zielflug [23.3K]
Okay, so this is basically telling you that there is no solution. You don't have to worry about there being one. You just have to justify (or explain) why there isn't one.

Basically, neither y or x is equal to anything. You couldn't make x equal to a value in y because x and y are both together in the equation and equal to numbers. 

We can always move a factor to the other side. So,

x-2y= -8

Add 2y to the other side.

x= -8+2y

Now, plug in -8+2y as x.

3(-8+2y)- 6y=-12

-24+6y-6y= -12

The 6y's cancel out. So, we can't figure out what y is.

-24=-12 <- no y.

These two lines are 
parallel. They have direct proportion in each other. That is why there is no solution because the lines never cross. Parallel lines do not cross. 

I hope this helps! 
~kaikers


6 0
4 years ago
What is the square root of 149? And please show me how to find the answer
chubhunter [2.5K]
The answer is 12.21 you find this by dividing 149 by ten and then 11 then 12 next 13 then realize you went too far and its some where around 12. somthing. I know that was confusing but thats the only way i can explain it or just put this into a calculator:

4 0
3 years ago
Other questions:
  • I understand this.....
    8·2 answers
  • According to the Rational Roots Theorem, which statement about f(x) = 25x7 – x6 – 5x4 + x – 49 is true?
    7·2 answers
  • A rectangle is drawn on a coordinate grid. The equation for 1 side of the rectangle is 3x - 2y = 12. Which could be an equation
    6·1 answer
  • I need help on number 22
    12·1 answer
  • Mathematical model in real life
    14·1 answer
  • Ben is 33 times as old as Daniel and is also 44 years older than Daniel. How old is Daniel?
    7·1 answer
  • What will be the 50th term in the sequence defined by an=11+5(n-1)
    7·1 answer
  • Evaluate the expression x - 9, if x = 12. 21 17 4 3
    11·1 answer
  • Plsss help I will mark brainlist plsss help fast
    14·1 answer
  • Helpppp please !!!!
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!