1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
ZanzabumX [31]
2 years ago
12

Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis

Mathematics
1 answer:
arsen [322]2 years ago
6 0

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

You might be interested in
What are the factors in 20x-11x+3 ?
sergiy2304 [10]
The factor(s) of this problem is→ 3(3x + 1)
8 0
3 years ago
Read 2 more answers
A coconut is a fruit that is made up of a hard outer shell that is spherical. Inside, there is a thick layer of coconut meat tha
Dvinal [7]

Answer:

V = 18816.57 in^3

Step-by-step explanation:

So we need to find the volume of the inner sphere. Try to picture the coconut as a circle with another circle inside of it. We know that the bigger circle is 55 inches wide, and the distance between the circumferences of the circles is 11 inches. that means the inner circle is 55 - 2(11) inches wide. This is because we have 11 inches of coconut meat on either side of the inner circle.

55 - 2(11) = 33 inches

The radius is half of the diameter, so r = 16.5 inches.

Now just use the formaula V = \frac{4}{3}\pi  r^{3}

V = (4/3) * 3.14 * (16.5)^3

V = 18816.57 in^3

<em>Also, just a side note.. this is one big coconut..</em>

7 0
3 years ago
Plz help plz plz plz​
Rama09 [41]

6 (x+5)

I hope this helps :))

3 0
3 years ago
Is it 290 or 70 is conjugate angle
Aleks [24]
A conjugate angle is 360°, 360-70=290!
6 0
2 years ago
An arithmetic sequence is defined by the general term tn = -5 + (n - 1)78, where n ∈N and n ≥ 1. What is the recursive formula o
Gnoma [55]

Answer:

C

Step-by-step explanation:

In general for arithmetic sequences, recursive formulas are of the form

aₙ = aₙ₋₁ + d,

and the explicit formula (like tₙ in your problem), are of the form

aₙ = a₁ + (n - 1)d,

where d is the common difference. So converting between the two of these isn't so bad. In this case, your problem wants you to have an idea of what t₁ is (well, every answer says it's -5, so there you are) and what tₙ₊₁ is. Using the formulas above and your given tₙ = -5 + (n - 1)78, we can see that the common difference is 78, so no matter what we get ourselves into, the constant being added on at the end should be 78. That automatically throws out answer choice D.

But to narrow it down between the rest of them, you want to use the general form for the recursive formula and substitute (n + 1) for every instance of n. This will let you find tₙ₊₁ to match the requirements of your answer choices. So

tₙ₊₁ = t₍ₙ₊₁₎₋₁ + d ... Simplify the subscript

tₙ₊₁ = tₙ + d

Therefore, your formula for tₙ₊₁ = tₙ + 78, which is answer choice C.

6 0
3 years ago
Read 2 more answers
Other questions:
  • Can someone please solve this problem?Quick!
    13·1 answer
  • What is 7/8 times 3/4
    9·2 answers
  • Help again please ..
    7·1 answer
  • Estimate the weight of a piece of cake.
    12·2 answers
  • How can you solve quadratic equations in one variable?
    7·1 answer
  • The larger cube’s volume is about blank cm
    7·1 answer
  • I need the answer to solving for x. I dont remember how to do these problems and I can't get it wrong because im in Summer schoo
    8·2 answers
  • The local ice cream shop surveyed the customers to see which flavor of ice cream is most popular 125 people choose chocolate as
    6·1 answer
  • Can somebody help me pleeaaassseee? 5 star rate
    8·2 answers
  • What is the measure of the base of the rectangle if the area of the triangle is 32ft^2?
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!