1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
ZanzabumX [31]
2 years ago
12

Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis

Mathematics
1 answer:
arsen [322]2 years ago
6 0

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

You might be interested in
Please help with this question!
Volgvan

Answer:

hey hope you get the answer right

Step-by-step explanation:

4 0
3 years ago
The second term of an arithmetic sequence is -39. The rule a, = a -1 + 12 can be used to find the next term of the
siniylev [52]

Step-by-step explanation:

the first one is the correct one

a, = -51+12(n-1)

a(2) = -51+12(2-1)=-39

I hope this helps

Im sure from the answer

but I couldnt explain it exactly

4 0
2 years ago
Read 2 more answers
Abby and her mom are driving on a road trip, and Abby is watching the milepost signs go by. Each hour she writes down which mile
OleMash [197]

Its linear. I looked it up. ;)

5 0
3 years ago
Read 2 more answers
How do you use protractors, its been printed on the paper, this is gonna be a little confusing for me sorry if I give this app a
Luda [366]

Answer:

  see below

Step-by-step explanation:

A protractor is usually a transparent measuring device laid intended to be laid over an angle to be measured. The centerpoint of the protractor's scale is made to coincide with the angle's vertex, and the baseline of the protractor is aligned with one of the angle's rays. The appropriate scale is used to read the angle where the other ray crosses the scale. You usually have to visually determine if the angle is acute or obtuse, so you can choose the correct scale to read.

__

If you're drawing an angle, first draw one ray and locate the vertex on it. Then do the steps above as you would for measurement. Make a mark on your paper corresponding to the desired angle measure, and connect the vertex to that mark to create the other ray of the angle.

__

If you're working with a printed protractor, you may need to do your work on a piece of translucent paper or transparency material, so you can see the protractor scale through the page you're drawing on.

_____

<em>Comment on a printed protractor</em>

A protractor will only give accurate measurements if its geometry is perfect. Some printers will scale a figure differently in horizontal and vertical directions, so will make the protractor scale be elliptical instead of circular. That will give wrong readings.

7 0
3 years ago
Ram is 3 times old as his son and the sum of their age is 48.how old is each?
stich3 [128]

Answer:

12 and 36

Step-by-step explanation:

x+3x=48

4x=48

divide by 4

x=12

48-12=36

6 0
3 years ago
Read 2 more answers
Other questions:
  • Which lines have slope -4/5 and contain point (0,1)?
    5·1 answer
  • A line passes through (1,-1) and (3,5) . What is the equation of the line in slope-intercept form?
    11·2 answers
  • What is the equation of a line passing through the points (2,1) and (-4,-1)?
    14·1 answer
  • Use a letter to represent the unknown Twenty packs of fruit snacks come in a box. Each pack weighs 6 ounces. Students eat some.
    10·2 answers
  • HELP please only have a couple of minutes.
    6·1 answer
  • Kira bought a picture frame.a calculator, and a toy. The picture frame cost four times as much as the calculator. The calculator
    11·1 answer
  • Thomas buys a case of bottled water. A case contains 36 bottles of water and it costs $4.68. How much does each water bottle cos
    5·1 answer
  • How much money do you save when you buy a $40 video game that is on sale for 25% off?
    13·2 answers
  • Enter the solutions from least to greatest. H (x)=(-4x -3)(x -3)h(x)=(−4x−3)(x−3)h, left parenthesis, x, right parenthesis, equa
    5·1 answer
  • Find m&lt;2<br> See picture for full problem. Please and thank you!
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!