Answer: I am a Shrub
Explanation:
A Shrub also called a bush is medium-sized woody plant with many stems which is shorter than a tree but taller than a herb having a range in height of about 6-10 metres Shrubs are divided into two --- Deciduous and evergreen.
Many Shrubs are planted in homes and gardens because of the aesthetic value they provide, including serving as wind breaks when many of them are planted together.Example of Shrubs include Rose, jasmine,Hibiscus tulsi, etc.
My best guess would be c because b makes no since we as humans do not have photosynthesis and are considered living organisims, d is also wrong because the brain requires oxygen, and its not a because the brain is made of cells.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The main reason why carbon atoms are so common in living things is because carbon is a very adaptable element in the sense that its electron configuration allows it to bond with many other atoms.
Male genitalia, and the stuff that comes out of it
