Because it has no scientific explanation. As a matter of fact it has no explanation.
The things that black cats cause bad luck are a myth, and do not have any proof or explanation, meaning it cannot be concluded neither as a hypothesis nor scientific.
Hope it helped,
BioTeacher101
Survivorship curve = so, first of all, it's a curve, as in a graph.
It describes "survivorship" - the rate of survival, in other words: out of 100 organisms that are born, how many survive. This rate is different among species, for example, most humans live out to most of their life span, and almost all can survive well beyond a reproductive age.
However, in frogs for example, many many individuals are born, but only few can survive to adulthood: most die very young, before reproductive age.
So if you hear about a new species: let's say dogs, and you want to know how long they would live, you would look at their sirvivorship curve (and in some breeds of dogs, those that are likely not to be in shelters, but in homes, the survivorship curve would be similar as in humans: almost all individuals born can live long.
In order for me to assist you, you must attach an image of the graph. :)
The physical area where the bear lives describes a grizzly bear’s habitat because habitat is <span>the natural home or environment of an animal.
D.</span><span>The physical area where the bear lives</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
