Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Option (2).
Explanation:
Ecological succession is the change in the ecological community of the species with respect to time. Two types of the succession are secondary succession and primary succession.
The ecological succession includes various transitional stages before reaching to the climax community. The simple species acquires first and then the climax species is reached at the end of the succession. Different changes are involved in the formation of climax community.
Thus, the correct answer is option (2).
Answer:
Fat from the Turkey
Explanation:
It's from the turkey. The fat solidified and the layer is floating at the top.
Answer:
Chromosome 17 is made of over million (80) base pairs.
Approximately how many genes are found on chromosome 17?
1600
Explanation:
took on edge2020 and got it right
hope this helps :)
Answer:
A hawk eats a snake, which has eaten a frog, which has eaten a grasshopper, which has eaten grass.
Explanation: A food web consists of all the food chains in a single ecosystem. Each living thing in an ecosystem is part of multiple food chains. Each food chain is one possible path that energy and nutrients may take as they move through the ecosystem.
