Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Adrenergic/effector/sympathetic
Explanation:
The two main divisions of autonomic nervous system are sympathetic nervous system and para sympathetic nervous system. This nervous system controls the involuntary actions of the body.
Adrenergic receptors are included in the G protein coupled receptors. Alpha and beat receptors are adrenergic receptors. These receptors are present on the effector molecule. Alpha and beta receptors are important during fight and flight response and are included in the sympathetic nervous system.
Thus, the correct answer is option (e).
Chromosomes <span>structures</span> contain DNA within the cell nucleus
Answer:
Information that are required to classify an organism are given below.
1. Unicellular or multicellular : First we have to see that from how many cells the body of organisms formed.
2. Composition of cell wall: Secondly we have to see the cell wall composition.
3. Prokaryotic or eukaryotic cell: We have to see the nucleus of organisms, if it has nucleus we can say that it is a eukaryotic cell.
4. Mode of nutrition: Mode of nutrition means is the organisms is autotroph or heterotroph.
If they have similarities, so it is placed in one group. If not so it is placed in different group or kingdom.
rough ER-ER-to-golig transport vesicles- Golgi cisternae- secretory or transport vesicles-cell surface... answer: exocytosis