1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Ann [662]
3 years ago
14

MULTIPLE CHOICE:

Biology
1 answer:
MariettaO [177]3 years ago
5 0
D. Surface tension surface tension it’s what makes insect walk on water
You might be interested in
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
The alpha and beta receptors are known as _________ receptors and are found at the ________ of the ________ division.
Law Incorporation [45]

Answer:

Adrenergic/effector/sympathetic

Explanation:

The two main divisions of autonomic nervous system are sympathetic nervous system and para sympathetic nervous system. This nervous system controls the involuntary actions of the body.

Adrenergic receptors are included in the G protein coupled receptors. Alpha and beat receptors are adrenergic receptors. These receptors are present on the effector molecule. Alpha and beta receptors are important during fight and flight response and are included in the sympathetic nervous system.

Thus, the correct answer is option (e).

3 0
3 years ago
Which structures contain DNA within the cell nucleus?
umka2103 [35]
Chromosomes <span>structures</span> contain DNA within the cell nucleus
5 0
3 years ago
Read 2 more answers
What information would you need to know in order to make an accurate classification of these organisms?
Shtirlitz [24]

Answer:

Information that are required to classify an organism are given below.

1. Unicellular or multicellular : First we have to see that from how many cells the body of organisms formed.

2. Composition of cell wall: Secondly we have to see the cell wall composition.

3. Prokaryotic or eukaryotic cell: We have to see the nucleus of organisms, if it has nucleus we can say that it is a eukaryotic cell.

4. Mode of nutrition: Mode of nutrition means is the organisms is autotroph or heterotroph.

If they have similarities, so it is placed in one group. If not so it is placed in different group or kingdom.

7 0
3 years ago
What is the normal pathway a cell uses to make and release proteins
dimaraw [331]

rough ER-ER-to-golig transport vesicles- Golgi cisternae- secretory or transport vesicles-cell surface... answer: exocytosis

3 0
3 years ago
Other questions:
  • Endoplasmic Reticulum -what is the function
    14·1 answer
  • Communicate your results if your hypothesis was correct. If your hypothesis was not correct, you should???
    7·1 answer
  • Which term describes the living and nonliving things in an area?
    5·2 answers
  • Which of the following is NOT a property of water? Group of answer choices It is less dense when frozen than when it's a liquid.
    14·1 answer
  • Describe the function of macromolecules
    9·2 answers
  • Which of the following describes a person swinging a bat?
    5·2 answers
  • What molecules can be used for long-term energy storage? ADP and fat Starch and fat ADP and ATP Starch and ATP
    12·2 answers
  • The type of mutation that alters the nucleotide sequence of a gene but does not alter the amino acid sequence of the protein pro
    8·1 answer
  • Could NaCi dissolve in water ?
    5·2 answers
  • Type the correct answer in the box. Spell all words correctly. What is the correct term for blocked sunlight and reduced solar r
    9·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!