1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Bumek [7]
3 years ago
10

What key client information should you have before you walk in to meet/assess your client?

Biology
1 answer:
anzhelika [568]3 years ago
3 0
<span>There is a few pieces of key information you should have available to you before greeting a new client. Knowing their name, gender, relative age, and reason for visit is helpful and necessary for greeting a new client. If you are greeting a client who is already under observation, having caregivers' previous reports are helpful.</span>
You might be interested in
What is the Kuiper belt and where is it located in our Solar system? (8 Points)
viktelen [127]
The Kuiper Belt is one of the largest structures in our solar system. Its inner edge begins at the orbit of Neptune, at about 30 AU from the Sun.
6 0
4 years ago
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
What's the answer to this question
Flauer [41]
The answer is C. Thermal energy is transferred to her face by radiation, and thermal energy is transferred to the bottoms of her feet by conduction. 

Conduction is a method of transferring heat by using the collision of molecules and free electrons (depending on the material). Heat is usually transferred by conduction if both objects are in contact with each other that way the molecules can collide and spread the kinetic energy thus raising their internal heat. So, since the feet and the sand are in contact, so the heat should be transferred by conduction. However, air is a very poor heat conductor, it cannot transfer heat efficiently, therefore, the first answer is not conduction. 

Radiation is a method of transferring heat too but using electromagnetic waves. It works great even in the air, or even with vacuum space. The sun shining from outer space to earth through the vacuum space is also by radiation. So, the first answer is radiation. 

The answer is C, hope it helps!
7 0
4 years ago
Suppose you cut open a leaf in cross section and observed stomata
fomenos
It’s monocot because dicots are found in the lower epidermis only
4 0
3 years ago
Which is not a compound?<br><br> A. 8H2<br><br> B. H20<br><br> C. 6CaO<br><br> D. 5HCl
BartSMP [9]
A because only an element is there which is H
7 0
3 years ago
Read 2 more answers
Other questions:
  • Jane is a researcher who studies the individual and collective aging processes in humans. jane works in the field of
    5·1 answer
  • How did cells originally get their name?
    14·1 answer
  • Need some help with this if at all possible. Hurry, please! Thank you.
    12·1 answer
  • What two things does Earth's atmosphere do with solar energy?​
    13·2 answers
  • What are the correct order of steps on how a reflex occurs?
    5·1 answer
  • I'll cashapp you 10$ if you help with 2 questions
    5·2 answers
  • Why did the ovary keep on progesterone production after fertilization​
    8·2 answers
  • Which sustainable building practice does the photograph show?
    6·2 answers
  • The Question is in the picture
    5·2 answers
  • Which statement is a fact
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!