virus being a none living organism outside a living cell makes it none living. to me, at this age, to make a living virus to go back to not living, is to subject the infected cells under high treatment or damage the cell totally.
bacteria can always be cured with antibiotics
The statement is true. This is because the chemical formula for a salt compound (a compound is made up of two or more atoms of elements) is NaCl, where Na is Sodium, and Cl is Chlorine. Hope this helps!
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Fold Mountains
Explanation:
"The rugged, soaring heights of the Himalayas, Andes, and Alps are all active fold mountains." - google
