Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Salutations!
What component of Earth’s atmosphere exists entirely as a result of photosynthesis?
Oxygen is the component of Earth's atmosphere that is existed entirely as a result of photosynthesis. Photosynthesis is a procedure that plants and other different organisms use sunlight to make their food. It is a chemical procedure.
Hope I helped (:
Have a great day!
Answer: Warm air rises, creating a low pressure zone; cool air sinks, creating a high pressure zone. Air that moves horizontally between high and low pressure zones makes wind. The greater the pressure difference between the pressure zones the faster the wind moves. Convection in the atmosphere creates the planet's weather.
Hope this helps... Stay safe and have a great weekend!!! :D
sorry if this isn't the right answer you are looking for...
Answer:
Your answer Is C!!!!! :)))
Explanation:
