1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Anna35 [415]
4 years ago
5

What is the surface area of the cylinder 

Mathematics
1 answer:
MaRussiya [10]4 years ago
3 0

Answer:

224π

Step-by-step explanation:

2πrh+2πr^{2} is the formula for finding the surface area of a cylinder.

14 ft is the diameter, so 7 ft would be the radius (r).

9 ft is the height (h).

Substitute in your values.  2π x 7 x 9 + 2π7^{2}  = 703.717 or 224π

You might be interested in
Does the order of the numbers in an ordered pair matter when naming a point? Can that point be represented by more than on order
babymother [125]
Ordered pairs are used to locate points on the graph. The first number in an ordered pair corresponds to the horizontal axis, and the second corresponds to the vertical axis.<span>
</span>
6 0
3 years ago
the sport field at patton elementryschool is shaped like a rectangle . the field is 72 yard lobg and 46 yardwide. what isthe are
valina [46]
Length x width will give you area so...

72 x 46 = 3,312 yards is the area
6 0
3 years ago
Phillip write an integer that is less than -2 and greater than -3.5 Which integer did he write?​
Rus_ich [418]
The answer would be -4
6 0
4 years ago
Read 2 more answers
Fission tracks are trails found in uranium-bearing minerals, left by fragments released during fission events. An article report
Harlamova29_29 [7]

Answer:

Mean track length for this rock specimen is between 10.463 and 13.537

Step-by-step explanation:

99% confidence interval for the mean track length for rock specimen can be calculated using the formula:

M±\frac{t*s}{\sqrt{N}} where

  • M is the average track length (12 μm) in the report
  • t is the two tailed t-score in 99% confidence interval (2.977)
  • s is the standard deviation of track lengths in the report (2 μm)
  • N is the total number of tracks (15)

putting these numbers in the formula, we get confidence interval in 99% confidence as:

12±\frac{2.977*2}{\sqrt{15}} =12±1.537

Therefore, mean track length for this rock specimen is between 10.463 and 13.537

4 0
3 years ago
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
Other questions:
  • 100th number in this sequence <br><br> 14 ,28 ,42 ,56
    7·1 answer
  • Please help me !! Thanks !
    7·1 answer
  • What is the name of the figure?
    14·2 answers
  • CAN SOMEONE HELP ME WITH THE QUESTION IPOSTED EARLIER IT LOOKS LIKE A LOT BUT IT IS NOT
    15·1 answer
  • Select all the numbers that are solutions to the equation x^3=9
    11·2 answers
  • For the GJW Clean Up event, Ms. Baran spent $37.95 on 23 packets of hand wipes for
    8·1 answer
  • Point D is the in center of triangle ABC. Write an expression for the length x in terms of the three side lengths AB, AC, BC.
    11·1 answer
  • Please help me with this homework
    12·1 answer
  • The bookstore sold m books on Monday and t books on Tuesday. But on Wednesday, r books were
    12·1 answer
  • What is the product of (2p 7)(3p2 4p – 3)? 6p3 29p2 – 34p 21 6p3 29p2 – 22p 21 6p3 29p2 22p – 21 6p3 29p2 34p – 21
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!