Glycolysis is the breakdown of metabolic materials into energy and pyruvic acid. it is supported by me because without energy we wouldn't be able to do anything and almost every thing we do requires energy from taking a walk down to the pumping of blood by the heart throughout the body
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Soil is composed of small pieces of a variety of materials, so it is a heterogeneous mixture.
Explanation:
Answer:
A. When two tectonic plates start to push into each other they can rise up and build mountains, or sink under and create deep valleys.
Explanation:
It is true
The correct answer is that "the T cell enters a state of anergy".
The activation of T cells requires two signals: (1) antigen specific signal presented by an antigen presenting cell (either a macrophage or a dendritic cell) that activates t cell receptors and (2) co-stimulatory signals that is not antigen specific but rather found in the plasma membrane of the antigen presenting cell (i.e. CD28). In the absence of a co-stimulatory signal, the t cell will enter a state of anergy or the inability to produce an immune response toward an offending antigen.