1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
fgiga [73]
3 years ago
8

WILL GIVE A BRAINLEST

Biology
1 answer:
alina1380 [7]3 years ago
7 0

The answer is C:the germ theory of disease

You might be interested in
Nearly all organisms on earth carry out some form of glycolysis. How does that fact support or not support the assertion that gl
Blizzard [7]
Glycolysis is the breakdown of metabolic materials into energy and pyruvic acid. it is supported by me because without energy we wouldn't be able to do anything and almost every thing we do requires energy from taking a walk down to the pumping of blood by the heart throughout the body
4 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Soil is best described as _______.
elena-14-01-66 [18.8K]

Answer:

Soil is composed of small pieces of a variety of materials, so it is a heterogeneous mixture.

Explanation:

6 0
2 years ago
*by my profile its actually not biology cause it didn'*t have science subject*
LuckyWell [14K]

Answer:

A. When two tectonic plates start to push into each other they can rise up and build mountains, or sink under and create deep valleys.

Explanation:

It is true

5 0
3 years ago
What occurs if a t cell binds to an antigen and the t cell does not receive a co-stimulatory signal?
tresset_1 [31]
The correct answer is that "the T cell enters a state of anergy".

The activation of T cells requires two signals: (1) antigen specific signal presented by an antigen presenting cell (either a macrophage or a dendritic cell) that activates t cell receptors and (2) co-stimulatory signals that is not antigen specific but rather found in the plasma membrane of the antigen presenting cell (i.e. CD28). In the absence of a co-stimulatory signal, the t cell will enter a state of anergy or the inability to produce an immune response toward an offending antigen.
4 0
3 years ago
Other questions:
  • Which cup is more denser? The one with the rice or the one with popcorn?
    10·1 answer
  • he population of Japanese sika deer in central Japan was determined each year from 2005 to 2014. The sika deer population underw
    11·1 answer
  • What is the effect on the tides when the gravitational force of the sun is added to that of the moon
    5·1 answer
  • Can you pls help me??​
    14·2 answers
  • How many mL of water would be displaced by 408 g of lead
    8·2 answers
  • What is the order in which sound waves travel through the ear?
    11·2 answers
  • How might a mutation in the DNA of the Piedmontese bull lead to muscle hypertrophy
    10·1 answer
  • PLEASE HELP URGENT
    14·2 answers
  • Along what types of tectonic plate boundaries <br> are volcanoes generally found? Why?
    14·1 answer
  • I NEED HELP!!!!<br> PLEASE READ THE QUEUSTION AND AWNSER IT'S A MULTI ANSWER.
    9·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!