1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Verizon [17]
3 years ago
11

About how many days pass between a new moon and a 3rd quarter moon?

Biology
1 answer:
Sever21 [200]3 years ago
7 0

Answer:

21 days

Explanation:

After another week (21 days after new moon) the moon has moved another quarter of the way around the Earth to the “third quarter phase”. The sun's light is now shining on the other half of the visible face of the moon

You might be interested in
The non sticky substance in chromosomal end<br>​
Ainat [17]
I think it’s a telomere
3 0
3 years ago
Rachel is studying the impact of watching television 30 minutes before bedtime on quality of sleep. Which of the following might
rodikova [14]

Answer:

''Watching television adversely impacted the quality of sleep''.

Explanation:

''Watching television adversely impacted the quality of sleep'' is the best hypothesis for her study. Watching television right before bed, can negatively impact your sleep quality. Late-night watching television disrupts your internal clock that adversely affected sleep quality of an individual. The above hypothesis is used by the Rachel to investigate the impact of watching television before sleeping on the sleep quality.

4 0
3 years ago
What animal eats fiddler crabs?<br><br>​
pogonyaev
Gulls, crows and herons are all opportunists. They'll eat just about anything that they can get their beaks on. That includes fiddler crabs.
5 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
HELP ! BIOLOGY! sorry my screen is hard to read but i need help with these two questions please !
kirill [66]

Answer:

2) B

3) D

I believe that these are the answers, I hope this helps!

3 0
2 years ago
Read 2 more answers
Other questions:
  • How much of Haiti’s forests have been cut down
    13·2 answers
  • Most meteorites contain iron and nickel and are therefore
    9·1 answer
  • An epidemiologist is a person who studies the and of diseases in . Word Bank: populationcontroltransmission
    10·1 answer
  • What can trace fossils tell you about ancient organisms?
    9·2 answers
  • How many nerves does the brain have
    5·1 answer
  • RasD oncogenes directly activate Cdc42 and Rac, which in turn, activate Rho. Which cancer hallmark does this contribute to:_____
    9·1 answer
  • 4. What will be the phenotype of the fly that grows from the fertilized cell shown
    13·1 answer
  • Which is not a function of the respiratory system? A. It warms air entering the body. B. It exchanges oxygen and carbon dioxide.
    9·2 answers
  • ¿Explique las diferencias fundamentales entre el núcleo de una célula animal y una vegetal?
    5·1 answer
  • which of the follwing is evolutionary evidence that whales and dolphins descended from land dwelling mammals'
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!