Answer:
''Watching television adversely impacted the quality of sleep''.
Explanation:
''Watching television adversely impacted the quality of sleep'' is the best hypothesis for her study. Watching television right before bed, can negatively impact your sleep quality. Late-night watching television disrupts your internal clock that adversely affected sleep quality of an individual. The above hypothesis is used by the Rachel to investigate the impact of watching television before sleeping on the sleep quality.
Gulls, crows and herons are all opportunists. They'll eat just about anything that they can get their beaks on. That includes fiddler crabs.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
2) B
3) D
I believe that these are the answers, I hope this helps!