Answer:
C
Explanation:
The mutation seen is most likely due to a frameshift mutation. A nucleotide was added or removed without replacement. This shifted the codon reading sequence by one nucleotide. Therefore the codon downstream of the mutation will code for different amino acids.
Answer:
The units and their physical quantities are the second for time, the metre for measurement of length, the kilogram for mass, the ampere for electric current, the kelvin for temperature, the mole for amount of substance, and the candela for luminous intensity.
It is a theory supported by overwhelming scientific evidence.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The correct answer is "the S layer may play a role in protecting cells from viruses and predatory bacteria found in nature but not in laboratory cultures".
Explanation:
The S-layer (surface layer) is a part of the cell's envelope comprised of of identical proteins or glycoproteins that could be found in archaes and some bacterias in nature. The function of the S-layer is unknown, however the fact that is only seen in nature suggest that it may play a role in protecting cells from viruses and predatory bacteria found in nature but not in laboratory cultures. It is likely that archaes and bacteria synthesize the S-layer when they recognize viruses and predatory bacteria in nature, the S-layer is not synthesized in laboratory cultures because these pathogens are not present.
