Answer: frameshift mutation
Explanation: A frameshift mutation is a particular type of mutation that involves either insertion or deletion of extra bases of DNA. Now, what's important here is the number three. The number of bases that are either added or subtracted can't be divisible by three.
Answer:
Its a substitution mutation because one of the specific base, G is replaced by A.
This is a Point Mutation because Point mutation brings changes in the structure of a gene because of the substitutions with another base pair. Like in this case, G is substituted by A. In case of frameshift mutations, there is a change in the number of nucleotides due to either insertions or deletions of the nucleotides, which is not in this case.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The majority of mutations are neutral in their effects on the organisms in which they occur. Beneficial mutations may become more common through natural selection. Harmful mutations may cause genetic disorders or cancer.
Explanation:
Answer:
C. It is active transport, and moves against the concentration gradient.
Explanation: Pinocytosis is an active transport in which the molecules move from a low to a more higher concentration gradient. During this process it requires energy to move molecules and the energy used is ATP.
