Answer:
Domain: (−∞,∞),{x|x∈R}
Step-by-step explanation:
the domain will be Domain: (−∞,∞),{x|x∈R} because
The domain of the expression is all real numbers except where the expression is undefined. In this case, there is no real number that makes the expression undefined.
Answer:
False
Step-by-step explanation:
I would say false;
This graph is really hard to read because of the way it's subdivided but one of the coordinate points is (0,-1) and the line clearly passes through the origin (0,0).
If you have the chance, please tell your teacher to provide better graphs that are actually readable.
Answer:
egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw
Answer:
C
Step-by-step explanation:
Total of 40 cups and 25 of them are chocolate so the proportion for chocolate would be 25/40
Answer:
9.6p + 0.4q + 2.2r meters (answer A)
Step-by-step explanation:
We sum up the three side lengths to obtain the perimeter of the triangle:
(6.2p + 4.5q) meters, , and (2.9r – 4.1q) meters
+ (3.4p – 0.7r) meters
+ (2.9r – 4.1q) meters
---------------------------------
9.6p + 0.4q + 2.2r meters (answer A)
