Answer: C) Muscle cell
Detailed Explanation:
Muscle cells contain the highest number of Mitochondria
Average annual precipitation and temperature.
<span>When the microscope was invented, it helped the cell theory. This invention allowed scientists to see that everything was made up of cells and see what cells do. They needed this invention in order to see that cells existed and study them more in depth.</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
