Answer:
1,645
Step-by-step explanation:
The relations are domain and range
Answer:
hmmmm
Step-by-step explanation:
Oki y 123
x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725
Step-by-step explanation:
For an absolute value function, the graph will look like an arrow with a sharp inflection point.
Reciprocal function will tend towards a limit when stretched to infinity.
Cube root and square root functions do not tend towards infinity at x = 0, because it is either 0 or the constant value.
The best answer here is Reciprocal. (B)
a) the independent variable is the number of training miles.
b) the dependent variable is the cost to mail the package
c) the dependent variable is P
