A true
<span> Before agriculture was developed people mostly were nomadic in nature. They moved from place to place in search of food. Some of them were groups of hunter gatherers as well. When agriculture started people also started to settle down in groups. This led to the development of civilization and in modern day cities and towns. The first agricultural practices were started beside the river banks due to the reason that the soil was very fertile and water for irrigation was also easily available. </span>
The speed of a sound wave depends upon the medium through which it travels. In general, sound travels faster through solids than through liquids or gases. Also, the denser the medium, the slower sound will travel through it. The same sound will travel at a different speed on a cold day than it would on a warm day.
Answer:
(E)
Explanation:
The binding of glucose to liver phosphorylase a shifts the equilibrium from the active form to the inactive form.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Any change in allele frequencies in a gene pool is a mutation
