1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
icang [17]
3 years ago
7

Where does an organism inherit its genetic instructions from

Biology
1 answer:
Stels [109]3 years ago
8 0

Answer:

Organism's parent.

Explanation:

Trait can be defined as the specific features or characteristics possessed by a living organism. It is essentially transferred from the parent of a living organism to her offspring and as such distinguishes him or her.

Simply stated, a trait refers to the distinguishing characteristic or quality of any living organism.

Some examples of traits in genetics are colorblindness, handedness, curly hair, height, complexion, weight, hair color, dimples, tongue-roll, etc.

For example, John is so tall and has a curly hair, it's obvious he acquired the trait from his mum.

In Genetics, a trait comprises of all the genetic instructions that are typically being transfered from the parent to their offsprings.

Hence, an organism inherit its genetic instructions from its parent.

You might be interested in
What is a recessive allele?
irinina [24]
An allele that can only be expressed when no dominant allele is present
7 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Reaction paper of fuming method
xenn [34]

Answer:

Cyanoacrylate, also called super glue, fuming is a chemical method for the detection of latent fingermarks on non-porous surfaces such as glass, plastic etc. The method relies on the deposition of polymerized cyanoacrylate ester on residues of latent fingermarks.Jul 18, 2017

Explanation:

4 0
3 years ago
How does soil become enriched during soil formation? a. by weathering b. through erosion c. by decaying organisms d. all of the
Nata [24]

The answer is C, by decaying organisms

8 0
3 years ago
Read 2 more answers
Peripheral vascular diseases are disorders of the blood vessels that are located outside of the heart and brain. a. True b. Fals
sladkih [1.3K]

Answer: True

Explanation: Peripheral vascular disease (PVD) is a blood circulation disorder that causes the blood vessels such as arteries (atherosclerosis) and veins outside the heart and brain to narrow, block, or spasm. PVD causes pain and fatigue especially during exercise. Risk factors may include ageing, diabetes and smoking.

3 0
4 years ago
Other questions:
  • What makes young herbaceous plant remain upright?
    14·2 answers
  • the hydrosphere includes all organisms on earth as well as the environments in which they live true or false
    8·1 answer
  • Which feature of the sun appears in cycles of 11 years
    11·1 answer
  • What is the type of sand Sue McGrew prefers to use for her sculptures? <br> (5 letters)
    13·2 answers
  • How does the experiment contribute to our understanding of altruism in different creatures?
    12·1 answer
  • Most bacteria growth best within certain range of condition. By manipulating _______________________, ____________________, ____
    14·1 answer
  • Please help! ASAP!
    11·1 answer
  • (50 points) Think about the renewing of cells in a human body. What would happen if new cells stopped forming when we reached ma
    5·2 answers
  • Is loss of predator a density-dependent or density-independent factor?
    12·2 answers
  • Dan has 5 toys Tan has 3 toys how many toys to they have
    7·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!