Answer:
to have symmetry on your body from side
to side
In a survey, it says that human's DNA are 99% the same.
Hope this helps! :)
Answer:
They used relative dating to divide Earth's past in several chunks of time when similar organisms were on Earth. Later, scientists used absolute dating to determine the actual number of years ago that events happened. The geologic time scale is divided into eons, eras, periods, and epochs.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
