Ask question

Ask question

All categories

3 years ago

15

Brittany is making hair bows to sell at a craft show. Each hair bow requires 3/4 yard of ribbon. Brittany plans to make 50 bows.

How many yards of ribbon does Brittany need to purchase?

2 answers:

Nadya [2.5K]3 years ago

7 0

Brittany would use 37 and 1/2

lapo4ka [179]3 years ago

5 0

50 · (3÷4) = 37.5

Because each ribbon requires 3/4 of a yard its just 50 3/4

You might be interested in

For the real-valued functions f(x)=2x+3 and g(x)=√x-5, find the composition fog and specify its domain using interval notation.

Burka [1]

Find fog

fog(x)
f(g(x))
f(√x-5)
2√(x-5)+3

For real range the domain

x-5≥0
x≥5

Domain is [5,oo)

7 0

1 year ago

Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis

arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0

2 years ago

A rectangle had a length of 2x-7 and a with of 3x+8y. Write and simplify an expression for the perimeter of that rectangle?

wel

Answer:

Step-by-step explanation:

A rectangle had a length of 2x-7 and a width of 3x+8y

Perimeter P = 2(l + w)

P = 2(2x - 7 + 3x + 8y)

P = 2(5x + 8y - 7)

P= 10x + 16y - 14

4 0

3 years ago

What is a similar triangle?

statuscvo [17]

$\large\text{Hey there!}$

$\large\text{\bf{Similar triangles}}}\large\text{ \underline{are basically} \boxed{\text{triangles that have the same SHAPE}}}\\\boxed{\large\text{but they can still be different. They can still be similar if one them is}}\\\boxed{\large\text{rotated or one of them is reflected image of the other triangle}}\checkmark$

$\large\text{Good luck on your assignment and enjoy your day!}$

~ $\dag\dfrac{\frak{LoveYourselfFirst}}{:)}$

5 0

3 years ago

Menos 10 * 12 * -4 + 40 * -2 * 6 - 2 por favor

SVEN [57.7K]

Answer:

-2

Step-by-step explanation:

-10 x 12 x -4 + 40 x -2 x 6 - 2

-120 x -4 - 80 x 6 - 2

480 - 480 - 2

0 - 2

-2

8 0

2 years ago