Answer:
C) production of sperm and eggs
Explanation:
Sperms and eggs are the male and female gametes respectively. Formation of sperms and egg cells require meiotic cell division. Meiosis in sperm mother cells and egg mother cells reduces the chromosome number of half in the sperms and eggs. Meiosis also adds new gene combinations in these gametes by the process of crossing over.
Mitosis cannot reduce the chromosome number to half in the sperms and eggs. Absence of crossing over in mitosis leads to the formation of genetically identical progeny cells from mitosis.
Hence, mitosis can not form sperms and egg cells. If it does, the sperms and egg cells would not have genetic variations and there would be doubling of chromosome number with each round of sexual reproduction.
Animal skulls are said to protect the one of the most important organ in the body. Moreover, the bone has also some features that are important such as being able to identify the organ of the animal, knowing somehow the lifespan, diet and other similar biological traits.
Thank you for your question. Please don't hesitate to ask in Brainly your queries.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
You just gotta do it no matter what happens
I believe that it's called an adaptation.
Hope I helped you
