Answer: they would maybe have to fight with the other beetles to tr and get the females attention
Explanation:
pls mark brainliest
Answer:
Meiosis involves two cell divisions
Explanation:
Mitosis and meiosis are two kinds of cell divisions and one of the main differences between the two is that meiosis goes through <u>2 nuclear divisions</u>.
Meiosis has Meiosis I and Meiosis II division. In Meiosis I, the number of chromosomes in the daughter cells are only half of the parent cells. This is why it is called a reduction division, because the chromosomes will be reduced by half. In Meiosis II, the daughter cells will have the same number of chromosomes as the parent cells, which in this case is the daughter cells of meiosis I.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
It refers to the idea the prehistoric oceans combined with lightning formed the building blocks of life.
Explanation:
The primordial soup refers to the idea that prehistoric oceans combined with lightning to form the building blocks of life.
The soup can be regarded as the soup of life through which the first nuclei acids were synthesized.
- It was a hypothesized set of conditions available when the earth was initially formed about 4.5 billion years ago.
- The miller-urey experiment was set up in 1930's to demonstrated this soup of life.
Learn more:
Earth brainly.com/question/4545456
#learnwithBrainly
Http://www.innerbody.com/image/musc01.html
YOU CAN FIND YOUR ANSWER HERE.
