All categories

2 years ago

Please place the following vessels in the correct order to represent the arterial circulation leading up to the glomerulus.

Biology

1 answer:

Ymorist [56]2 years ago

5 0

The following vessels are connected as below:

aorta ->renal arteries ->segmental arteries ->interlobular arteries ->arcuate arteries ->cortical radiata ->afferent arteries ->glomerulus.

1) aorta : arises from heart which carry blood from heart to the rest of the body

2) renal artery :it arises from the aorta which carry blood to kidney .it carry unfiltered blood .

3)segmental arteries : it arises from renal artery .it has 5 branches or segments.

4)interlobular arteries : it arises from segmental arteries. the interlobular arteries pass directly outward between the medullary rays to reach the fibrous tunic ,where they end in the capillary network of this part.

5)Arcuate arteries: it arises from interlobular arteries .it is also known as arciform arteries, are vessels of the renal circulation. they are located at the border of the renal cortex and renal medulla.

6) cortical radiata: it arises from arcuate arteries.

7) afferent arteries: it arises from interlobular arteries and also connects to glomerulus. they are a group of blood vessels that supply the nephrons in many excretory systems .they play a important role in regulation of blood vessels.

8) glomerulus : it connects from afferent arteries.it is the filtering unit of kidney ,is a specialised bundle of capillaries that are uniquely situated between two resistance vessels.

Disclaimer: the given question is incomplete means it contains incomplete data .the correct question is given below.

Question: Please Place The Following Vessels In The Correct Order To Represent The Arterial Circulation Leading Up To The Glomerulus. Aorta Interlobar Artery Segmental Artery Afferent Arteriole Cortical Radiate Renal Artery Arcuate Artery Glomerulus

Please place the following vessels in the correct order to represent the arterial circulation leading up to the glomerulus.

Aorta

Interlobar artery

Segmental artery

Afferent arteriole

Cortical radiate

Renal artery

Arcuate artery

Glomerulus

Learn more about blood vessels here :

brainly.com/question/11763276

#SPJ4

You might be interested in

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0

3 years ago

Where is the carbon taken in by plants during photosynthesis stored?

AURORKA [14]

The answer is b. plant structures.

Photosynthesis is the process by which plants use solar energy to produce glucose from carbon dioxide and water. Carbon dioxide enters the leaves, plant structures, through the<span> stoma and is incorporated into organic compounds. </span>

8 0

4 years ago

Read 2 more answers

All the black widow spiders on a 5 acre farm

pogonyaev

The answer is B. Population

8 0

3 years ago

Read 2 more answers

_______________, harmful or helpful, is considered to be the source for new alleles and a main contributor to the diversity of l

ololo11 [35]

The right answer is A mutation.

Alteration of the genetic material (DNA or RNA) of a cell or virus that causes a change in certain traits due to the inheritance of this genetic material from generation to generation.

Abnormal modification of the DNA of a gene, either spontaneously during cell division, or under the influence of external agents called mutagens. This gene is modified to be transmitted to the daughter cells. Some mutations have no effect on the cell. Others are the first step in a long process of cancerization.

Rare are the mutations that are beneficial.

7 0

3 years ago

Read 2 more answers

When studying pea plants, Gregor Mendel made many interesting discoveries and came to a few conclusions about what happens as a

Art [367]

Answer:

The options have been placed in the comment section. The answer is C. Inheritance of genes from both parents

Explanation:

Gregor Mendel is referred to as the FATHER OF GENETICS due to his immense contribution to the discovery of how traits are passed down or inherited from parents to offsprings. He found out that a unit of inheritance, which was later called GENE, was responsible for each individual trait of pea plants.

In his numerous experiments, Mendel discovered that the characteristics/traits of pea plants were determined by the contribution of both parents. Mendel hypothesized that each parent contributed 50% of this unit of inheritance via fertilization to the characteristics of an offspring. Hence, the inheritance of genes from both parents determines the characteristics of a pea plant.

6 0

3 years ago