1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
AnnyKZ [126]
3 years ago
5

Which of the following is NOT something that Earth's atmosphere protects us from? A. meteoroids B. ultraviolet light C. greenhou

se gases D. dangerous particles from space
Chemistry
2 answers:
Katarina [22]3 years ago
8 0
The answer in C. Greenhouse Gases. Greenhouse Gases is caused by the trapped heart in the atmosphere harming us which we will always have. hope this helped
QveST [7]3 years ago
3 0

Answer:

The correc answer is C. greenhouse gases.

Explanation:

The atmosphere is a layer of gases that surrounds our planet and is one of the essential elements for life on it.

The atmosphere protects us from harmful solar radiation from the Sun. The Sun, in addition to light and heat (infrared radiation), emits other radiation such as gamma rays, X-rays and ultraviolet rays that are harmful to life. These harmful radiations are absorbed by the atmosphere.

The atmosphere also protects us from the impacts of meteorites. These are from outer space are attracted by gravity and fall on the earth's surface. Upon coming into contact with the gases of the atmosphere, at high speed, the friction causes them to heat up so much that they become incandescent and end up disintegrating, avoiding reaching the ground. Only the largest (rare) can pass through the atmosphere and reach the ground.

Something similar happens that with meteorites occurs with the dangerous particles of space.

Greenhouse gases contribute, to a greater or lesser extent, to the increase of the greenhouse effect, since they are capable of absorbing the heat energy carried by long-wave radiations that are reflected by the Earth's surface.This phenomenon prevents the solar energy constantly received by the Earth from returning immediately to space and causing the temperature of the air near the ground to rise. Then there are changes in the climate such as sea level rise, changes in rainfall, disappearance of forests, extinction of organisms and problems for agriculture.

So <u><em>the correc answer is C. greenhouse gases.</em></u>

You might be interested in
The oxidation number of Na in NaCl a. 0 b. -1 c. +1 d. -2 e. +2
Dahasolnce [82]
NaCl:

Na = + 1

Cl = - 1

hope this helps!
4 0
3 years ago
Why is it necessary to use clean sponge and cleaning rags in dishwashing?​
NARA [144]

Answer:

cloths/sponges can harbor harmful pathogens and spread germs if not cleaned frequently. A damp, smelly dish cloth/sponge is telling you germs are multiplying!

Explanation:

hope this is able to help you :)

6 0
2 years ago
Balance the equation for ethane C3H6 burning in oxygen to form carbon dioxide and steam. _____C3H6 + ____ O2 ---&gt; CO2 + ____H
aleksandrvk [35]

Answer:

   2C3H6 + 9 O2 ---> 6 CO2 + 6 H2O

Explanation:

8 0
3 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
The major products obtained from the following sequence of reactions are:
dmitriy555 [2]

Answer:

The answer is "Option C".

Explanation:

Please find the complete question and its solution in the attached file.

using Hoffman's elimination reaction.

7 0
3 years ago
Other questions:
  • Which cannot be separated into similar substances? Compound,element,solution ormixture
    5·1 answer
  • Determine the percent composition of sodium in sodium carbonate
    14·1 answer
  • How many grams of sodium chloride are present in a 0.75 M solution with a volume of 500.0 milliliters?
    13·2 answers
  • When a chemical is in the gaseous state, it has definite mass, but its shape is independent of the shape of the container in whi
    8·1 answer
  • Nitrogen and hydrogen gases are combined at high temperatures and pressures to produce ammonia, NH3. If 101.7 g of N2 are reacte
    8·2 answers
  • Which reaction will occur?
    8·2 answers
  • Identify the area where convection is taking place when boiling three eggs in a pan of water
    7·1 answer
  • Is anyone good at chemistry if so can someone help me please ?<br><br> (NO LINKS)
    12·1 answer
  • How to do 3 and 4 questions
    8·1 answer
  • Is each oxide basic, acidic, or amphoteric in water: (a) SeO₂ ;
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!