1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Anton [14]
3 years ago
9

Alvin’s family used 20.5 gallons of gas to Drive 492 miles. How many miles did they drive on each gallon of gas

Mathematics
2 answers:
Morgarella [4.7K]3 years ago
7 0
Since they use 20.5 gallons in 492 miles you need to divide 492/20.5 which gives you 24
Virty [35]3 years ago
5 0

Answer: 24.0

Step-by-step explanation:

divide 492 and 20.5

You might be interested in
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
2 years ago
What common denominator would you use to find equivalent, fractions to compare 4/8, 3/4, and 1/2?
Fofino [41]

Answer:

LCD = 8

Step-by-step explanation:

4/8=4/8

3/4= 6/8

1/2=4/8

6 0
2 years ago
Read 2 more answers
Which of the lists of letters all have line symmetry?
Sunny_sXe [5.5K]

Answer:

The first row

Step-by-step explanation:

Letters A,B,C,D

6 0
3 years ago
Read 2 more answers
Wore
zhuklara [117]
“kilo-“ means “thousand.” A kilogram is 1,000 grams.
5 kg = 5,000 g
5,000 g × (1 pizza)/(300 g) = 5,000/300 pizzas = 16⅓
16 pizzas
4 0
3 years ago
a sayian's power level is 400 septillion if he goes super sayian 3 and it multiplies his power by 900 trillion what is his power
QveST [7]
It's over 9 thousand
7 0
3 years ago
Read 2 more answers
Other questions:
  • Determine whether the data shows a linear relationship. If so, write an equation of a line of it.
    10·1 answer
  • Write the equation in standard form.<br><br> 8−5y=−2x
    11·1 answer
  • What is the place value of 0 in 37.0691 ​
    9·2 answers
  • How many meters are there in 234 cm?
    5·2 answers
  • (Unicamp-SP) Em uma agência bancária 5 caixas atendem os clientes em fila única. Suponha que um atendimento de cada cliente demo
    13·1 answer
  • 23. Which set of values represents the domain of th
    5·1 answer
  • What is greater 9/3, 2 3/4​
    6·1 answer
  • -18x+2x-15x+23x-12x-4x <br> Combine like terms
    7·2 answers
  • Which of the following would be found on a consumer’s credit report?
    5·2 answers
  • Subtract: (–3x2 + 7 – 2x) – (6 + 7x – 4x2)
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!