1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
viktelen [127]
3 years ago
9

What does the axial skeleton consist of ??

Health
1 answer:
posledela3 years ago
6 0
Hello There! ^_^

Your question: What does the axial skeleton consist of ..?

Your answer: The axial skeleton consists of a trunk of a vertebrae and the bones of the head.

Happy Studying!


You might be interested in
Proteins supply the body with __________ calories of energy per gram.
MrRissso [65]
Calories indicate and measure the energy available in food. Protein each contain 4 calories per gram.
5 0
2 years ago
What is the third step in the STOP method of refusing negative peer pressure?
Murljashka [212]

Answer:

B. Observe the situation

Explanation:

A common method that is recommended for refusing negative peer pressure is known as the STOP method. STOP is an acronym that stands for:

Stop

Take a breath

Observe the situation

Proceed

6 0
3 years ago
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
1 year ago
Alfred was recently diagnosed with schizophrenia and has since started taking Thorazine. He meets with Dr. Wayne to evaluate his
Butoxors [25]

Answer: a. may alleviate the negative symptoms of schizophrenia.

Explanation:

Thorazine is a drug which is used for the purpose of treatment of psychotic disorders like schizophrenia and manic-depression. It is associated with side effects like drowsiness, anxiety, increasing suicidal tendencies. The Clozaril is the drug which is also effective in treating schizophrenia when other medications are ineffective. This can be used to reduce the risk of suicidal behavior. It also reduces anxiety, depression and stress.

4 0
2 years ago
Rebecca would like to get started on a Mediterranean diet for optimal health. Which changes would you recommend?
AlekseyPX
 That she changes her meats and how many calories they are.
6 0
3 years ago
Read 2 more answers
Other questions:
  • Which describes why people typically fall into binge-eating habits?
    15·2 answers
  • Is the belief that one's personality or behavior is exhibited in a way that first addresses one's most basic
    9·2 answers
  • Rupert told you yesterday that he has ordered some steroids to help him improve on the football field. You are trying to talk hi
    15·1 answer
  • Pain during sports is completely normal and should not be a concern.
    15·1 answer
  • Appropriate limits encourage children to develop
    6·1 answer
  • How do you measure good health?<br><br> Who ever has the best answer gets 100 points
    6·1 answer
  • How is tempeh generally used?
    11·1 answer
  • Where did Tinikling Dance originated​
    9·2 answers
  • Simplify <br><img src="https://tex.z-dn.net/?f=%20%5Csqrt%7B21%20-%2020i%7D%20" id="TexFormula1" title=" \sqrt{21 - 20i} " alt="
    9·1 answer
  • Oklahoma Connections Academy physical education unit 1 lesson 5 your health and wellness unit test
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!